DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14511 and meigo

DIOPT Version :9

Sequence 1:NP_651675.1 Gene:CG14511 / 43445 FlyBaseID:FBgn0039641 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097853.1 Gene:meigo / 42510 FlyBaseID:FBgn0250820 Length:338 Species:Drosophila melanogaster


Alignment Length:346 Identity:84/346 - (24%)
Similarity:138/346 - (39%) Gaps:63/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLSIRAISAICGVFLGCC---SGVVFLELL-------VKLDPGAGNLITGAQFAFIALEGFIFT 55
            |||..|:...|..|.:..|   .|:|..:|.       |:.|...|...|.|    :||......
  Fly     1 MNLPERSRFVIYAVGIFVCYFLYGIVQEKLTRGRYGEEVQTDGSVGERFTYA----LALVWVQCL 61

  Fly    56 SKFGLAQRVISLR----------DYALLVAMFFLTSVCNNYVFKFKVPMTLHMIIRGGSLISNMC 110
            ..:..|:.::::|          .|......:.|..|..|...:: ||....::.:....|..|.
  Fly    62 CNYVFAKVLLTIRPQKEDTTNAGSYVACSLTYLLAMVSTNMAMRW-VPYPTAVVGKSAKPIPVMI 125

  Fly   111 LCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKMENLDSGAEADTFWWLLGVALLVLAL 175
            |..||.::||..::|..||.|.:|:.:..|..     ||:.||    .|:|  .|||..||.|:|
  Fly   126 LGVLIGRKSYSWTRYACVLTIVLGVILFMYKE-----GKVSNL----PAET--TLLGEVLLFLSL 179

  Fly   176 FVSSYMGITQELLYRR---HGKCAREALYYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLG 237
            .:....|..||.:...   .|:....|:.:...|.|..            .:.||||:.:.....
  Fly   180 SMDGLTGAVQERIRAASAPSGQQMMRAMNFWSTLMLGV------------AMVFTGEAKEFMYFT 232

  Fly   238 VAVP-----LILLYLLGNVLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFT 297
            :..|     |.|:.:.| ||.|..    ::.:......|..:::.|.|||.:::.|::.|.|...
  Fly   233 IRHPEAWTHLSLIAVCG-VLGQFF----IFLMVASFGPLACSVVTTTRKFFTVLCSVLLFGNVLI 292

  Fly   298 WWHWLGTALVFVGTLMFANVI 318
            ...|||..|||..  :|.:::
  Fly   293 ARQWLGAVLVFAA--LFVDML 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14511NP_651675.1 UAA 6..318 CDD:285625 81/339 (24%)
meigoNP_001097853.1 UAA 8..311 CDD:285625 80/337 (24%)
EamA 169..308 CDD:304911 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.