DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and ALG13

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_011468.1 Gene:ALG13 / 852835 SGDID:S000003015 Length:202 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:47/176 - (26%)
Similarity:80/176 - (45%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYITVG-TTKFDALISTASTEPALKALQNRKCTKLVIQHG------------------NSQPLTD 51
            :::|.| |..|..|:|...::...:.|......:|:||.|                  .||.:..
Yeast     9 LFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPI 73

  Fly    52 DEI-------QLIRKNYGIQIEQYNFRPNTEDI--KSADLIIGHAGAGTCMDILNNQKPGLIVIN 107
            |:.       |.:..|..:::..::|....:.|  ..:||:|.|||.|:.:|.|...||.::.:|
Yeast    74 DQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVN 138

  Fly   108 DTLMDNHQLELAKQLAAENYLYYCKVTDVD--AQLATLDFEALKPY 151
            |:||||||.::|.:.....|::.|..|:..  |.|.....|.|||:
Yeast   139 DSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 47/176 (27%)
ALG13NP_011468.1 Glycosyltransferase_GTB-type 8..202 CDD:415824 47/176 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341346
Domainoid 1 1.000 63 1.000 Domainoid score I2473
eggNOG 1 0.900 - - E1_COG5017
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I1753
Isobase 1 0.950 - 0 Normalized mean entropy S1930
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - oto100399
orthoMCL 1 0.900 - - OOG6_102820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.630

Return to query results.
Submit another query.