DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and AT4G16710

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001328517.1 Gene:AT4G16710 / 827374 AraportID:AT4G16710 Length:176 Species:Arabidopsis thaliana


Alignment Length:149 Identity:52/149 - (34%)
Similarity:80/149 - (53%) Gaps:8/149 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQHGNS--QPLTDDEIQLIRKNYGIQIEQY 68
            |::|||||.||||:....::.....||.|..|.|:||.|..  .|...|     ..:..:.::.:
plant    12 VFVTVGTTSFDALVKAVVSQNVKDELQKRGFTHLLIQMGRGIFFPTKCD-----GADGSLVVDYF 71

  Fly    69 NFRPNTED-IKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQLAAENYLYYCK 132
            .|..:..| |:||.|:|.|||:|:..:.|...||.::|:|:.||||||.|||:.|....:|||.:
plant    72 TFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEALEERKHLYYTR 136

  Fly   133 VTDVDAQLATLDFEALKPY 151
            ...:...|..::..:|..|
plant   137 PHSLHQTLTKMELGSLVQY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 52/149 (35%)
AT4G16710NP_001328517.1 Glyco_tran_28_C 11..170 CDD:397977 52/149 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2771
eggNOG 1 0.900 - - E1_COG5017
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44843
Inparanoid 1 1.050 87 1.000 Inparanoid score I2326
OMA 1 1.010 - - QHG57268
OrthoDB 1 1.010 - - D1575485at2759
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - oto3750
orthoMCL 1 0.900 - - OOG6_102820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4114
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.