DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and Alg13

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_080523.2 Gene:Alg13 / 67574 MGIID:1914824 Length:165 Species:Mus musculus


Alignment Length:169 Identity:57/169 - (33%)
Similarity:93/169 - (55%) Gaps:15/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNTVYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQHGNS----QPLTDDEIQLIRKNYGI 63
            :...::|||||.||.|::.......::.|::.....||:|.|..    :|...:...|       
Mouse     1 MKRAFVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTESFTL------- 58

  Fly    64 QIEQYNFRPN-TEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQLAAENY 127
              :.|.::.: .||::.|||:|.|||||:|::.|...||.::|:|:.||:|||.||||||..|.:
Mouse    59 --DVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGH 121

  Fly   128 LYYCKVTDVDAQLATLDFEALKPYET-KPENLSKFVSAI 165
            |:||..:.:...|.::|...||.|.. :||..|.|:..:
Mouse   122 LFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 57/167 (34%)
Alg13NP_080523.2 Glycosyltransferase_GTB_type 5..>120 CDD:299143 44/123 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6926
eggNOG 1 0.900 - - E1_COG5017
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - otm44368
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12867
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.