DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and alg13l

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001017108.1 Gene:alg13l / 549862 XenbaseID:XB-GENE-5852383 Length:165 Species:Xenopus tropicalis


Alignment Length:168 Identity:67/168 - (39%)
Similarity:101/168 - (60%) Gaps:17/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQ--HGNSQP---LTDDEIQLIRKNYGIQ 64
            ||::|||||.||.|||..|.:..::.|:.....:|::|  .|..:|   .|.|.:          
 Frog     4 TVFVTVGTTSFDDLISCVSAKETVRILKGLGYNRLILQIGRGTIEPAPCCTSDFL---------- 58

  Fly    65 IEQYNFRPN-TEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQLAAENYL 128
            :|.:.::.: .||||||||:|.|||||:|::.|...||.::|||:.||.|||:||||||..:.:|
 Frog    59 LEFFRYKDSLVEDIKSADLVISHAGAGSCLETLGEGKPLIVVINEQLMSNHQIELAKQLYKDGHL 123

  Fly   129 YYCKVTDVDAQLATLDFEALKPYET-KPENLSKFVSAI 165
            |||..:.:...|.|::..|||.:.. ||||.:.|:..:
 Frog   124 YYCTCSTIGNTLQTMNLSALKNFSPGKPENFAAFLDKV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 67/168 (40%)
alg13lNP_001017108.1 Glycosyltransferase_GTB-type 5..159 CDD:385653 66/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6061
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44843
Inparanoid 1 1.050 120 1.000 Inparanoid score I4619
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1575485at2759
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - oto105615
Panther 1 1.100 - - LDO PTHR12867
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 1 1.000 - - X4114
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.