powered by:
Protein Alignment CG14512 and otud4
DIOPT Version :9
Sequence 1: | NP_651673.1 |
Gene: | CG14512 / 43443 |
FlyBaseID: | FBgn0039639 |
Length: | 171 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005174208.2 |
Gene: | otud4 / 327127 |
ZFINID: | ZDB-GENE-030131-5338 |
Length: | 1363 |
Species: | Danio rerio |
Alignment Length: | 37 |
Identity: | 13/37 - (35%) |
Similarity: | 16/37 - (43%) |
Gaps: | 2/37 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 QLAAENYLY--YCKVTDVDAQLATLDFEALKPYETKP 155
||:..|.|| |.|....|....|:..|.|...:|.|
Zfish 299 QLSGSNRLYSAYVKEVSPDNGPVTVFIEELNKQQTVP 335
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2026 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.