DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and otud4

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_005174208.2 Gene:otud4 / 327127 ZFINID:ZDB-GENE-030131-5338 Length:1363 Species:Danio rerio


Alignment Length:37 Identity:13/37 - (35%)
Similarity:16/37 - (43%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QLAAENYLY--YCKVTDVDAQLATLDFEALKPYETKP 155
            ||:..|.||  |.|....|....|:..|.|...:|.|
Zfish   299 QLSGSNRLYSAYVKEVSPDNGPVTVFIEELNKQQTVP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 13/37 (35%)
otud4XP_005174208.2 OTU 41..>120 CDD:327703
TUDOR 293..340 CDD:119391 13/37 (35%)
Atrophin-1 <526..941 CDD:331285
Atrophin-1 793..>1141 CDD:331285
RAM <1311..1355 CDD:317693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.