DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and Glt28d2

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_796104.2 Gene:Glt28d2 / 320302 MGIID:2443773 Length:165 Species:Mus musculus


Alignment Length:169 Identity:60/169 - (35%)
Similarity:97/169 - (57%) Gaps:15/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNTVYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQHGNS----QPLTDDEIQLIRKNYGI 63
            :..|::|||||.||.||:......:::.|:|....:||:|.|..    :|.:.:...|       
Mouse     1 MKRVFVTVGTTSFDDLIARVVAHDSVQILKNLGYNQLVLQIGRGTVVPEPFSTESFTL------- 58

  Fly    64 QIEQYNFRPN-TEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQLAAENY 127
              :.|.::.: .||::.|||:|.|||||:|::.|...||.::|:|:.||:|||.||||||..|.:
Mouse    59 --DVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGH 121

  Fly   128 LYYCKVTDVDAQLATLDFEALKPYET-KPENLSKFVSAI 165
            |:||..:.:...|.::|...||.|.. :||..|.|:..:
Mouse   122 LFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 60/167 (36%)
Glt28d2NP_796104.2 Glycosyltransferase_GTB_type 4..>120 CDD:299143 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830770
Domainoid 1 1.000 101 1.000 Domainoid score I6926
eggNOG 1 0.900 - - E1_COG5017
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44843
Inparanoid 1 1.050 109 1.000 Inparanoid score I4890
Isobase 1 0.950 - 0 Normalized mean entropy S1930
OMA 1 1.010 - - QHG57268
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - otm44368
orthoMCL 1 0.900 - - OOG6_102820
Panther 1 1.100 - - LDO PTHR12867
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 1 1.000 - - X4114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.