DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and otu

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster


Alignment Length:102 Identity:17/102 - (16%)
Similarity:29/102 - (28%) Gaps:49/102 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KNYGIQIEQYNFRPNTEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQLA 123
            |.|.:.|..|||:               .||...:::.|                          
  Fly   326 KLYNVYINDYNFK---------------VGAKCKVELPN-------------------------- 349

  Fly   124 AENYLYYCKVTDVDAQ-------LATLDFEALKPYET 153
             |..:|.|.|.::...       :..:..|.:.|||:
  Fly   350 -ETEMYTCHVQNISKDKNYCHVFVERIGKEIVVPYES 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 17/102 (17%)
otuNP_511089.2 OTU 37..>115 CDD:303090
TUDOR 335..392 CDD:197660 14/93 (15%)
TAF12 <446..>564 CDD:304643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44368
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.