DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and Alg13

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001013973.1 Gene:Alg13 / 300284 RGDID:1359416 Length:165 Species:Rattus norvegicus


Alignment Length:174 Identity:57/174 - (32%)
Similarity:95/174 - (54%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNTVYITVGTTKFDALISTASTEPALKALQNRKCTKLVIQHG---------NSQPLTDDEIQLIR 58
            :...::|||||.||.|::.......::.|::.....||:|.|         :::|.|        
  Rat     1 MKRAFVTVGTTSFDDLVARVVANDTVQILKSLGYNHLVLQIGRGTVVPEPFSTEPFT-------- 57

  Fly    59 KNYGIQIEQYNFRPN-TEDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELAKQL 122
                  ::.|.::.: .||::.|||:|.|||||:|::.|...||.::|:|:.||:|||.||||||
  Rat    58 ------LDVYRYKESLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQL 116

  Fly   123 AAENYLYYCKVTDVDAQLATLDFEALKPYET-KPENLSKFVSAI 165
            ..|.:|:||..:.:...|.::|...||.|.. :||..|.|:..:
  Rat   117 HKEGHLFYCTCSMLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 57/172 (33%)
Alg13NP_001013973.1 Glycosyltransferase_GTB_type 5..>120 CDD:299143 44/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7487
eggNOG 1 0.900 - - E1_COG5017
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4856
OMA 1 1.010 - - QHG57268
OrthoDB 1 1.010 - - D1575485at2759
OrthoFinder 1 1.000 - - FOG0003695
OrthoInspector 1 1.000 - - oto98920
orthoMCL 1 0.900 - - OOG6_102820
Panther 1 1.100 - - LDO PTHR12867
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4114
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.