DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14512 and LOC108349244

DIOPT Version :9

Sequence 1:NP_651673.1 Gene:CG14512 / 43443 FlyBaseID:FBgn0039639 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_038956244.1 Gene:LOC108349244 / 108349244 RGDID:11453602 Length:988 Species:Rattus norvegicus


Alignment Length:110 Identity:18/110 - (16%)
Similarity:36/110 - (32%) Gaps:42/110 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KFDALISTASTEPALKALQNRKCTKLVIQHGNSQPLTDDEIQLIR----KNYGIQIEQYNFRPNT 74
            :|||.:.|.      |.||...|    :::|.......|:.|:..    |.|...|::       
  Rat   266 EFDAWLDTR------KELQKSDC----LEYGGRYYYLGDKCQVCMEPGGKYYNAHIQE------- 313

  Fly    75 EDIKSADLIIGHAGAGTCMDILNNQKPGLIVINDTLMDNHQLELA 119
                                 ::|:...::|..:...:.|.:.:|
  Rat   314 ---------------------IDNENTSVLVFIEEFAERHLIPMA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14512NP_651673.1 Glyco_tran_28_C 5..168 CDD:282021 18/110 (16%)
LOC108349244XP_038956244.1 OTU 36..>115 CDD:418725
Tudor_SF 285..363 CDD:413384 10/81 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.