DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdhb and AT2G34590

DIOPT Version :9

Sequence 1:NP_651668.1 Gene:Pdhb / 43437 FlyBaseID:FBgn0039635 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_181006.1 Gene:AT2G34590 / 818024 AraportID:AT2G34590 Length:406 Species:Arabidopsis thaliana


Alignment Length:337 Identity:130/337 - (38%)
Similarity:205/337 - (60%) Gaps:15/337 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AFSTSQKALAAKQMTVRDALNSALDDELARDDRVFILGEEVAQYDGAYKVSRGLWKKYGDKRVID 80
            |.|||.|  ...::.:.:||...|::|:.||..|.::||:|..|.|:|||::||..|:||.||:|
plant    75 ASSTSSK--PGHELLLFEALQEGLEEEMDRDPHVCVMGEDVGHYGGSYKVTKGLADKFGDLRVLD 137

  Fly    81 TPITEMGFAGIAVGAAMAGLRPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNVPIVFRGPNG 145
            |||.|..|.|:.:||||.|||||.|.|...|.:.|.:.|.|:.....|.|.|...:|:|.|||.|
plant   138 TPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNCGMLHYTSGGQFTIPVVIRGPGG 202

  Fly   146 AASGVAAQHSQCFAAWYAHCPGLKVL---SPYDAEDARGLLKSAIRDPDPVVFLENELVYGTAFP 207
            ....:.|:|||...:::...||::::   :||   :|:||:|:|||..:||:..|:.|:|.    
plant   203 VGRQLGAEHSQRLESYFQSIPGIQMVACSTPY---NAKGLMKAAIRSENPVILFEHVLLYN---- 260

  Fly   208 VADNVADKDFLVPIGKAKVMRPGKDITLVAHSKAVETSLLAAAELAKKGIEAEVINLRSIRPLDT 272
            :.:::.|::::..:.:|:::|||:.||::.:|:.....:.||..|..||.:.|||::||::|.|.
plant   261 LKESIPDEEYICNLEEAEMVRPGEHITILTYSRMRYHVMQAAKTLVNKGYDPEVIDIRSLKPFDL 325

  Fly   273 ATIFASVRKTHHLVTVENGWPQHGVGAEICARIMEDQTFFE-LDAPVWRCAGVDVPMPYAKTLEA 336
            .||..||:|||.::.||......|:||.:.|.|.|:  |.: |||||...:..|||.|||.|||.
plant   326 YTIGNSVKKTHRVLIVEECMRTGGIGASLTAAINEN--FHDYLDAPVMCLSSQDVPTPYAGTLEE 388

  Fly   337 HALPRVQDLVEA 348
            ..:.:...:|.|
plant   389 WTVVQPAQIVTA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhbNP_651668.1 PLN02683 2..352 CDD:215368 130/337 (39%)
TPP_PYR_E1-PDHc-beta_like 33..199 CDD:132919 71/168 (42%)
Transketolase_C 222..340 CDD:280875 49/118 (42%)
AT2G34590NP_181006.1 odpB 84..406 CDD:177066 125/326 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0022
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D875272at2759
OrthoFinder 1 1.000 - - FOG0002922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101309
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.