DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdhb and BCKDHB

DIOPT Version :9

Sequence 1:NP_651668.1 Gene:Pdhb / 43437 FlyBaseID:FBgn0039635 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_000047.1 Gene:BCKDHB / 594 HGNCID:987 Length:392 Species:Homo sapiens


Alignment Length:342 Identity:119/342 - (34%)
Similarity:178/342 - (52%) Gaps:17/342 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RAFSTSQKALAAKQMTVRDALNSALDDELARDDRVFILGEEVAQYDGAYKVSRGLWKKYGDKRVI 79
            |.:..:||      |.:..::.||||:.||:|....|.||:|| :.|.::.:.||..|||..||.
Human    63 REYGQTQK------MNLFQSVTSALDNSLAKDPTAVIFGEDVA-FGGVFRCTVGLRDKYGKDRVF 120

  Fly    80 DTPITEMGFAGIAVGAAMAGLRPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNV-PIVFRGP 143
            :||:.|.|..|..:|.|:.|...:.|....::...|.|.|:|.|||..|.|....|. .:..|.|
Human   121 NTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSP 185

  Fly   144 NGAASGVAAQHSQCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENELVYGTAFPV 208
            .|.....|..|||...|::|||||:||:.|.....|:|||.|.|.|.:|.:|.|.:::|..|   
Human   186 WGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAA--- 247

  Fly   209 ADNVADKDFLVPIGKAKVMRPGKDITLVAHSKAVETSLLAAAELAKK--GIEAEVINLRSIRPLD 271
            |:.|..:.:.:|:.:|:|::.|.|:||||....|.. :...|.:||:  |:..|||:||:|.|.|
Human   248 AEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHV-IREVASMAKEKLGVSCEVIDLRTIIPWD 311

  Fly   272 TATIFASVRKTHHLVTVENGWPQHGVGAEICARIMEDQTFFELDAPVWRCAGVDVPMPYAKTLEA 336
            ..||..||.||..|:.........|..:||.:.:.| :.|..|:||:.|..|.|.|.|:  ..|.
Human   312 VDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQE-ECFLNLEAPISRVCGYDTPFPH--IFEP 373

  Fly   337 HALPRVQDLVEATLKVL 353
            ..:|......:|..|::
Human   374 FYIPDKWKCYDALRKMI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhbNP_651668.1 PLN02683 2..352 CDD:215368 118/339 (35%)
TPP_PYR_E1-PDHc-beta_like 33..199 CDD:132919 65/166 (39%)
Transketolase_C 222..340 CDD:280875 42/119 (35%)
BCKDHBNP_000047.1 PTZ00182 66..390 CDD:185502 118/337 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0022
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.