DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdhb and CG8036

DIOPT Version :9

Sequence 1:NP_651668.1 Gene:Pdhb / 43437 FlyBaseID:FBgn0039635 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_649812.2 Gene:CG8036 / 41027 FlyBaseID:FBgn0037607 Length:626 Species:Drosophila melanogaster


Alignment Length:327 Identity:74/327 - (22%)
Similarity:120/327 - (36%) Gaps:76/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRTRLIQAASSAQRAFSTSQKALAAKQMTV----RDALNSALDDELARDDRVFILGEEVAQYDGA 62
            :.|||         |:.|:...:....:.|    .|..||...|:|                   
  Fly   319 IATRL---------AYGTALAKIGQNNLRVVALDGDTKNSTFSDKL------------------- 355

  Fly    63 YKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGLRPVCEFMTW-NFSMQAIDHIINSAAKT 126
                    |....:|.|:..|.|....|:||||| ...|.|....|: .|..:|.|.|       
  Fly   356 --------KNLDPQRYIECFIAEQNLVGVAVGAA-CRRRTVAFVSTFATFFTRAFDQI------- 404

  Fly   127 FYMSAGAV---NVPIVFRGPNGAASGVA------AQHSQCFAAWYAHCPGLKVLSPYDAEDARGL 182
               ..||:   ||..|     |:..|.:      :|......|.:...||..:..|.||......
  Fly   405 ---RMGAISQTNVNFV-----GSHCGCSIGEDGPSQMGLEDIAMFRTIPGSTIFYPSDAVSTERA 461

  Fly   183 LKSAIRDPDPVVFLENELVYGTAFPVADNVADKDFLVPIGKAKVMR--PGKDITLVAHSKAVETS 245
            ::.| .:...|.|:.      |:.|....:.|.:....||:.||:|  ...::.|:.....:...
  Fly   462 VELA-ANTKGVCFIR------TSRPNTCVIYDNEEPFTIGRGKVVRQKSSDEVLLIGAGITLYEC 519

  Fly   246 LLAAAELAKKGIEAEVINLRSIRPLDTATIFASVRKT-HHLVTVENGWPQHGVGAEICARIMEDQ 309
            |.||.:|.|..|...||:..:::|||...|....::. ..:|.||:.:.|.|:|..:.:.:..::
  Fly   520 LAAADQLEKNCITVRVIDPFTVKPLDAELIIEHGKQCGGRVVVVEDHYQQGGLGEAVLSALAGER 584

  Fly   310 TF 311
            .|
  Fly   585 NF 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhbNP_651668.1 PLN02683 2..352 CDD:215368 74/327 (23%)
TPP_PYR_E1-PDHc-beta_like 33..199 CDD:132919 40/175 (23%)
Transketolase_C 222..340 CDD:280875 24/93 (26%)
CG8036NP_649812.2 PRK05899 8..624 CDD:235639 74/327 (23%)
TPP_TK 19..270 CDD:238970
TPP_PYR_DXS_TK_like 324..478 CDD:132916 44/203 (22%)
Transketolase_C 496..616 CDD:280875 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.