DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdhb and CG5103

DIOPT Version :9

Sequence 1:NP_651668.1 Gene:Pdhb / 43437 FlyBaseID:FBgn0039635 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_649036.1 Gene:CG5103 / 40012 FlyBaseID:FBgn0036784 Length:623 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:114/299 - (38%) Gaps:53/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RDALNSALDDELARDDRVFILGEEVAQYDGAYKVSRGLWKKYGDK-------RVIDTPITEMGFA 89
            |.|..:||....|.:.||..|       ||..|.|     .|.||       |.|:....:....
  Fly   319 RLAYGTALAKIAADNPRVIAL-------DGDTKNS-----TYADKMRNAFPERFIECFTAQQNLV 371

  Fly    90 GIAVGA-----AMAGLRPVCEFMTWNFS---MQAIDHI-INSAAKTFYMSAGAVNVPIVFRGPNG 145
            |:||||     .:|.:.....|.|..|.   |.||.|. :|.|......|.|.       .||  
  Fly   372 GVAVGATCRRRTVAFVSTYATFFTRAFDQIRMGAISHTNVNFAGSHCGCSIGE-------DGP-- 427

  Fly   146 AASGVAAQHSQCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENELVYGTAFPVAD 210
                  :|......|.:...||..|..|.||......::.| .:...|.::.      |.:|...
  Fly   428 ------SQMGLEDMAMFRSIPGSTVFYPTDAVSTERAVELA-ANTKGVCYIR------TTYPSTT 479

  Fly   211 NVADKDFLVPIGKAKVMR--PGKDITLVAHSKAVETSLLAAAELAKKGIEAEVINLRSIRPLDTA 273
            .:.:.|.:..:|..||:|  |..::.|:.....:...|.||..|.:..|.|.||:..:::|||..
  Fly   480 VIYNNDEVFAVGLGKVVRQKPSDEVLLIGAGVTLYECLAAAERLEEDCITARVIDPFTVKPLDVG 544

  Fly   274 TIFASVRKTH-HLVTVENGWPQHGVGAEICARIMEDQTF 311
            .|....:... .:|.||:.:.|.|:|..:.:.:.:.:.|
  Fly   545 LIVKHGKLCRGRIVVVEDHYQQGGLGEAVLSALADYRNF 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhbNP_651668.1 PLN02683 2..352 CDD:215368 74/299 (25%)
TPP_PYR_E1-PDHc-beta_like 33..199 CDD:132919 45/181 (25%)
Transketolase_C 222..340 CDD:280875 25/93 (27%)
CG5103NP_649036.1 PRK05899 12..621 CDD:235639 74/299 (25%)
TPP_TK 19..263 CDD:238970
TPP_PYR_DXS_TK_like 321..474 CDD:132916 45/186 (24%)
Transketolase_C 493..613 CDD:280875 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.