DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdhb and CG17691

DIOPT Version :9

Sequence 1:NP_651668.1 Gene:Pdhb / 43437 FlyBaseID:FBgn0039635 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001015354.3 Gene:CG17691 / 3355069 FlyBaseID:FBgn0039993 Length:364 Species:Drosophila melanogaster


Alignment Length:330 Identity:117/330 - (35%)
Similarity:174/330 - (52%) Gaps:18/330 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KQMTVRDALNSALDDELARDDRVFILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGI 91
            |:|.:.:|:|:|:|..|..:....:.||:|. :.|.::.|..|..|||.:||.:||:.|.|.||.
  Fly    41 KRMNMFNAINNAMDLALDENKSALLFGEDVG-FGGVFRCSVNLRDKYGSQRVFNTPLCEQGIAGF 104

  Fly    92 AVGAAMAGLRPVCEFMTWNFSMQAIDHIINSAAKTFYMSAGAVNV-PIVFRGPNGAASGVAAQHS 155
            |:|.|..|...:.|....::...:.|.|:|.|||..|.|.|..:. .:.||.|.||....|..||
  Fly   105 AIGVANTGATAIAEIQFADYIFPSFDQIVNEAAKYRYRSGGLFDCGSLTFRVPCGAVGHGALYHS 169

  Fly   156 QCFAAWYAHCPGLKVLSPYDAEDARGLLKSAIRDPDPVVFLENELVYGTAFPVADNVADKDFLVP 220
            |...|::||.|||:|:.|.....|:||:.:.||||:|.:..|.:.:|..|   .:.|..:.:...
  Fly   170 QSPEAYFAHTPGLRVVVPRGPIKAKGLILACIRDPNPCIVFEPKTLYRAA---VEEVPAEYYTSQ 231

  Fly   221 IGKAKVMRPGKDITLVAHSKAVETSLLAAAELAKK--GIEAEVINLRSIRPLDTATIFASVRKTH 283
            :|||.::|.|||:||:.....|.. ||..||:||.  .|:.|||:|.||.|.|..||..|.:||.
  Fly   232 LGKADILRHGKDVTLIGWGTQVHV-LLEVAEIAKSTLNIDCEVIDLVSILPWDAITICTSAKKTG 295

  Fly   284 HLVTVENGWPQHGVGAEICARIMEDQTFFELDAPVWRCAGVDVPMPYAKTLEAHALP-------R 341
            .::.........|.|:|:.:.|.| :.|..|:|||.|.||.|.|.|:  ..|...:|       .
  Fly   296 RVIIAHEAPLTQGFGSELASYIQE-KCFLHLEAPVKRVAGWDTPFPH--VFEPFYMPDKHRCLSA 357

  Fly   342 VQDLV 346
            :.|:|
  Fly   358 INDIV 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhbNP_651668.1 PLN02683 2..352 CDD:215368 117/330 (35%)
TPP_PYR_E1-PDHc-beta_like 33..199 CDD:132919 62/166 (37%)
Transketolase_C 222..340 CDD:280875 47/119 (39%)
CG17691NP_001015354.3 PTZ00182 10..362 CDD:185502 116/328 (35%)
TPP_PYR_E1-PDHc-beta_like 48..213 CDD:132919 62/165 (38%)
Transketolase_C 233..353 CDD:280875 48/123 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0022
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.