DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-Ib and MNS2

DIOPT Version :9

Sequence 1:NP_651667.1 Gene:alpha-Man-Ib / 43436 FlyBaseID:FBgn0039634 Length:685 Species:Drosophila melanogaster
Sequence 2:NP_566675.1 Gene:MNS2 / 821668 AraportID:AT3G21160 Length:572 Species:Arabidopsis thaliana


Alignment Length:462 Identity:201/462 - (43%)
Similarity:290/462 - (62%) Gaps:36/462 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ERQSAVVAAFKHSWAGYKKYAWGHDNLKPISQYSHEWF-GLGLTIVDSLDTMYIMGLDDEFKEGR 297
            :|...|..|..|:|:.|:|||||.|.|:|.::...:.| |||.|::|:|||:||||||::|::.|
plant    97 QRMQRVKEAMVHAWSSYEKYAWGQDELQPQTKDGVDSFGGLGATMIDALDTLYIMGLDEQFQKAR 161

  Fly   298 DWVEQSLRFDTKRDVNLFEVTIRVLGGLLSAYHLSGDTMFLAKAAELGNRLLPAFQSPSNIPYSD 362
            :||..||.||.....::||.||||:|||||||.||||.:||.||.::.:|||||:.:.|.|||:.
plant   162 EWVASSLDFDKDYAASMFETTIRVVGGLLSAYDLSGDKIFLEKAMDIADRLLPAWDTQSGIPYNI 226

  Fly   363 VNLGDLSAHSPKWS-PDSSTSEVTTIQLEFRDLSRSTNISIYEQVAHKVNEKVHDLEKN---HGL 423
            :||...:||:|.|: .||..::..|.||||..||:.|....|:|   ||.:.:..|.||   .||
plant   227 INLKHGNAHNPTWAGGDSILADSGTEQLEFIALSQRTGDPKYQQ---KVEKVISVLNKNFPADGL 288

  Fly   424 VPIFINANTGTFRNYATISLGARGDSYYEYLLKQWIQTGRKDNDNLILDYM----QAVDGVLTQL 484
            :||:||.:|.. .:.:||:.||.|||:||||||.|: .|.|  .:.:..|.    ::::|:|:.:
plant   289 LPIYINPDTAN-PSQSTITFGAMGDSFYEYLLKVWV-FGNK--TSAVKHYRDMWEKSMNGLLSLV 349

  Fly   485 MRRTPREHWVYIGELINGKDFKPKMDHLTCYLPGTLILGHQNGMPD-----SHLILARDLLDTCY 544
            .:.||.. :.||.|. :|.....|||.|.|:.||.|.|| .:|..|     ..|.||.:|..|||
plant   350 KKSTPLS-FTYICEK-SGNSLIDKMDELACFAPGMLALG-ASGYSDPAEGKKFLTLAEELAWTCY 411

  Fly   545 QTYMMNPTHLAAEISYFALTEKDDQDIYVKPNDAHNLLRPEFVESLYYFYSITGNRTYQDMGWKI 609
            ..|...||.||.| :||..:..|     :....:.|:||||.||||:|.:.:|||:|||:.||.|
plant   412 NFYQSTPTKLAGE-NYFFNSGSD-----MSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNI 470

  Fly   610 FQAFETHAKVNAGYTSMGNVKNTQSTRLRD-LMESFWMSETLKYFYLLFSDDRKEIDLEQWVFNS 673
            |:|||.::::.:||..:.:|    :|.::| .|:||:::|||||.||||| ....|.|::||||:
plant   471 FEAFEKNSRIESGYVGLKDV----NTGVKDNKMQSFFLAETLKYLYLLFS-PTTVIPLDEWVFNT 530

  Fly   674 EGHPLPV 680
            |.|||.:
plant   531 EAHPLKI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Man-IbNP_651667.1 Glyco_hydro_47 242..680 CDD:279825 199/452 (44%)
MNS2NP_566675.1 Glyco_hydro_47 105..537 CDD:279825 199/452 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54359
OrthoDB 1 1.010 - - D693882at2759
OrthoFinder 1 1.000 - - FOG0002927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.