DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul5 and AT1G59800

DIOPT Version :9

Sequence 1:NP_651665.2 Gene:Cul5 / 43434 FlyBaseID:FBgn0039632 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_176189.1 Gene:AT1G59800 / 842273 AraportID:AT1G59800 Length:255 Species:Arabidopsis thaliana


Alignment Length:130 Identity:36/130 - (27%)
Similarity:64/130 - (49%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SKKN-PTEDSPVRKLMLDSWNKHIFHDIKHRLQESAMKIVHAERNGDAYDAQLVVGVRESYVNLS 266
            |||. |:    :|::.|:.:...::.:::....|:.:.::|.||.|:..|.:||..|.:.:|   
plant   118 SKKGLPS----LREVGLNCFRDQVYREMQSMAAEAILALIHKEREGEQIDRELVRNVIDVFV--- 175

  Fly   267 SNAEDKLEIYRENFEMAYLKATVEFYRLKSAEQQQENGVLAYMKYADSKLREEEVRAKRYLEPSS 331
            .|....|:.|.|:||...|:.|..:|..|::...||...|.|.......|:.|..|...||.|::
plant   176 ENGMGTLKKYEEDFERLMLQDTASYYSSKASRWIQEESCLDYTLKPQQCLQRERERVTHYLHPTT 240

  Fly   332  331
            plant   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul5NP_651665.2 Cullin 33..743 CDD:279260 36/130 (28%)
CULLIN 520..655 CDD:214545
Cullin_Nedd8 779..846 CDD:214883
AT1G59800NP_176189.1 Cullin 41..>255 CDD:279260 36/130 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.