DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul5 and AT4G12100

DIOPT Version :9

Sequence 1:NP_651665.2 Gene:Cul5 / 43434 FlyBaseID:FBgn0039632 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_192947.1 Gene:AT4G12100 / 826818 AraportID:AT4G12100 Length:434 Species:Arabidopsis thaliana


Alignment Length:289 Identity:59/289 - (20%)
Similarity:107/289 - (37%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LDSWN--KHIFH---DIKHRLQESA----MKIVHAERNGDAYDAQLVVGVRESYVNLSSNAEDKL 273
            |..|:  :.:||   .:..:||:..    ::::..||.|.|.:            |.|...::.:
plant   189 LTLWDVGQKLFHKQLSMAPQLQDQVITGILRLITDERLGKAAN------------NTSDLLKNLM 241

  Fly   274 EIYRENFEMAY------LKATVEFYRLKSAEQQQENGVLAYMKYAD-SKLREEEVRAKRY-LEPS 330
            :::|..::..|      |.:|.:||..::.:..|.:.:..|:||.: :.|.|||...|.| ...|
plant   242 DMFRMQWQCTYVYKDPFLDSTSKFYAEEAEQVLQRSDISHYLKYVERTFLAEEEKCDKHYFFFSS 306

  Fly   331 SFSILTYTLVNVLIVDHLNSIIAECPALIRDYE-TERLNLMFRLMDRVMHGVGVEPMMGDLQRHI 394
            |.|.|...|.:.|:..| :|.:.|...|:.|.. .:.|..|:||...|                 
plant   307 SRSRLMKVLKSQLLEAH-SSFLEEGFMLLMDESLIDDLRRMYRLFSMV----------------- 353

  Fly   395 MSAGLADMLSASEVITQDSEKYVERLL------------------ELFNKFSDLVRNAFNDDPRF 441
                             |||.|::|:|                  ||......:....|..|   
plant   354 -----------------DSEDYIDRILRAYILAKGEGARQEGSLQELHTSIDKIWHQCFGQD--- 398

  Fly   442 LTARDIAFKTVVNDTSVFKMELPTSIANR 470
                |:..||:.:....|.:.:|...:::
plant   399 ----DLLDKTIRDCFEGFGLHVPGEFSDQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul5NP_651665.2 Cullin 33..743 CDD:279260 59/289 (20%)
CULLIN 520..655 CDD:214545
Cullin_Nedd8 779..846 CDD:214883
AT4G12100NP_192947.1 Cullin 82..>412 CDD:279260 57/276 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.