DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul5 and AT3G46910

DIOPT Version :9

Sequence 1:NP_651665.2 Gene:Cul5 / 43434 FlyBaseID:FBgn0039632 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:98 Identity:19/98 - (19%)
Similarity:47/98 - (47%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KHIF--HDIKHRLQESAMKIVHAERNGDAYD-AQL------VVGVRESYVNLSSNAEDKLEIYRE 278
            ||:|  ..::.:|....::::..:|:..:.| .||      |:.|..:.:|..........:|:.
plant   144 KHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVMSVHMTQLNNLRGLFYGQSLYKS 208

  Fly   279 N-FEMAYLKATVEFYRLKSAEQQQENGVLAYMK 310
            . |:..::...||||..::.:.::::.:..|:|
plant   209 PFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul5NP_651665.2 Cullin 33..743 CDD:279260 19/98 (19%)
CULLIN 520..655 CDD:214545
Cullin_Nedd8 779..846 CDD:214883
AT3G46910NP_190275.1 Cullin 33..>244 CDD:279260 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.