DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul5 and AT3G46910

DIOPT Version :10

Sequence 1:NP_651665.2 Gene:Cul5 / 43434 FlyBaseID:FBgn0288875 Length:852 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:98 Identity:19/98 - (19%)
Similarity:47/98 - (47%) Gaps:10/98 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 KHIF--HDIKHRLQESAMKIVHAERNGDAYD-AQL------VVGVRESYVNLSSNAEDKLEIYRE 278
            ||:|  ..::.:|....::::..:|:..:.| .||      |:.|..:.:|..........:|:.
plant   144 KHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVMSVHMTQLNNLRGLFYGQSLYKS 208

  Fly   279 N-FEMAYLKATVEFYRLKSAEQQQENGVLAYMK 310
            . |:..::...||||..::.:.::::.:..|:|
plant   209 PFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul5NP_651665.2 Cullin 17..744 CDD:459983 19/98 (19%)
Cullin_Nedd8 779..846 CDD:214883
AT3G46910NP_190275.1 Cullin 30..>244 CDD:459983 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.