DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and SIR2

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_010242.1 Gene:SIR2 / 851520 SGDID:S000002200 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:396 Identity:80/396 - (20%)
Similarity:135/396 - (34%) Gaps:138/396 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPKQEMDVAQSYITRAKMNPAKKDNEKRRRKDAMRRVSMILRKCDSMRT----TEDRQFLEKHPD 80
            |..|::..|.| :|..: :|..|....|..||..|.::.:|  |..:|.    |.| .|::|   
Yeast   194 ERVQDLGSAIS-VTNVE-DPLAKKQTVRLIKDLQRAINKVL--CTRLRLSNFFTID-HFIQK--- 250

  Fly    81 MVKTTKKRKERVEIYKERVVEREDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRG 145
                                                   :..|:.::..||||:||:..|||:|.
Yeast   251 ---------------------------------------LHTARKILVLTGAGVSTSLGIPDFRS 276

  Fly   146 SQGIWTL-----LQKGQDIGEHDLSSANPT---------------YT--HMALYELHRRRLLHHV 188
            |:|.::.     |...||:..:::...:|:               |:  |..:..|..:..|...
Yeast   277 SEGFYSKIKHLGLDDPQDVFNYNIFMHDPSVFYNIANMVLPPEKIYSPLHSFIKMLQMKGKLLRN 341

  Fly   189 VSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCR---PNSVYWRQFDTTEM-TARYCHKTHR-- 247
            .:||.|.|...:|:..:.|.:.||:.....|..|.   |....:.:....|: ...||:|..|  
Yeast   342 YTQNIDNLESYAGISTDKLVQCHGSFATATCVTCHWNLPGERIFNKIRNLELPLCPYCYKKRREY 406

  Fly   248 -----------------LCHRCSEPLY---------DTIVHFGERGNVKWPLNWAGATANAQRAD 286
                             :..|   |.|         ..|..|||....|:   ......:....|
Yeast   407 FPEGYNNKVGVAASQGSMSER---PPYILNSYGVLKPDITFFGEALPNKF---HKSIREDILECD 465

  Fly   287 VILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNL--QWTP---------KDAIASIKINGKCD 340
            :::|:|:||||           .|..:     :||:  ...|         |.|...:.:.|.||
Yeast   466 LLICIGTSLKV-----------APVSE-----IVNMVPSHVPQVLINRDPVKHAEFDLSLLGYCD 514

  Fly   341 QVMAQL 346
            .:.|.:
Yeast   515 DIAAMV 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 57/278 (21%)
SIR2NP_010242.1 DUF592 104..261 CDD:368003 19/113 (17%)
SIRT1 255..517 CDD:238699 60/283 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.