DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and sirt4

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001005988.1 Gene:sirt4 / 791628 ZFINID:ZDB-GENE-041010-65 Length:310 Species:Danio rerio


Alignment Length:277 Identity:77/277 - (27%)
Similarity:124/277 - (44%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGI---------------WTLLQKGQD---- 158
            :|||...||||..|...:|||:||.:.||||| |:|:               :...:|.:.    
Zfish    40 LEQLQAFISQASRLFVISGAGLSTESGIPDYR-SEGVGLYARTNRRPMQHSEFVRSEKSRQRYWA 103

  Fly   159 ---IGEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCK 220
               :|....||..|...|:||.:...:..||.:|:||.|.|||::|..|  |:|:||:.:..||.
Zfish   104 RNYVGWPQFSSHQPNSAHLALRDWEEKGKLHWLVTQNVDALHLKAGQQR--LTELHGSTHRVVCL 166

  Fly   221 NC---RPNSVYWRQFDTT----EMTA--------RYCHKTHRL------CHRCSEPLYDTIVHFG 264
            :|   .|.:...::|...    |.||        .:..:...|      |:.|...|...:..||
Zfish   167 DCGELTPRAELQKRFTALNPGWEATACAVAPDGDVFLEEEQVLNFRVPACNACGGVLKPEVTFFG 231

  Fly   265 E---RGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTP 326
            :   |..|.:..|      ....:|.:|..||||:|...|.:|.   ..:.::..|.:||:..|.
Zfish   232 DVVNRNTVHFVHN------KLAESDAVLVAGSSLQVFSGYRFLL---AASERKLPIAIVNIGATR 287

  Fly   327 KDAIASIKINGKCDQVM 343
            .|.:..|:::.:|.:|:
Zfish   288 ADHLTDIRVSARCGEVL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 68/259 (26%)
sirt4NP_001005988.1 SIRT4 43..304 CDD:238700 74/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.