DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and Sirt4

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:XP_036021467.1 Gene:Sirt4 / 75387 MGIID:1922637 Length:393 Species:Mus musculus


Alignment Length:294 Identity:78/294 - (26%)
Similarity:119/294 - (40%) Gaps:66/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 APHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQ-GIWTLLQK------------- 155
            :|.:...|:::|...||.:|.|:..|||||||.:.|||||..: |::....:             
Mouse    74 SPPLDPEKIKELQRFISLSKKLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHIDFVRSAP 138

  Fly   156 -------GQDIGEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGN 213
                   ...:|....||..|...|.||....|...||.:|:||.|.||.::|..|  |:|:||.
Mouse   139 VRQRYWARNFVGWPQFSSHQPNPAHWALSNWERLGKLHWLVTQNVDALHSKAGSQR--LTELHGC 201

  Fly   214 MYVEVCKNCRPNSV-------------YWRQ-----------FDTTEMTARY---CHKTHRLCHR 251
            |:..:|.||...:.             .|..           |.|.|....:   |      |.|
Mouse   202 MHRVLCLNCGEQTARRVLQERFQALNPSWSAEAQGVAPDGDVFLTEEQVRSFQVPC------CDR 260

  Fly   252 CSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPA----- 311
            |..||...:|.||:..|   |..........:.||.:|.:||||:|............|.     
Mouse   261 CGGPLKPDVVFFGDTVN---PDKVDFVHRRVKEADSLLVVGSSLQVPDSVRVAVAFAHPTGFILT 322

  Fly   312 --RQRAKICVVNLQWTPKDAIASIKINGKCDQVM 343
              .|:..|.::|:..|..|.:|.:|::.:|.:::
Mouse   323 AREQKLPIAILNIGPTRSDDLACLKLDSRCGELL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 72/268 (27%)
Sirt4XP_036021467.1 SIRT4 85..356 CDD:238700 76/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.