DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and Sirt3

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001171275.1 Gene:Sirt3 / 64384 MGIID:1927665 Length:334 Species:Mus musculus


Alignment Length:201 Identity:58/201 - (28%)
Similarity:85/201 - (42%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LVCYTGAGISTAALIPDYRG-SQGIWTLLQKGQDIGEHDL------------------------- 164
            :|...||||||.:.|||:|. ..|:::.||      ::|:                         
Mouse    75 VVVMVGAGISTPSGIPDFRSPGSGLYSNLQ------QYDIPYPEAIFELGFFFHNPKPFFMLAKE 133

  Fly   165 ---SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNS 226
               ....|..||..|..||.:.||..:.:||.|||...||:|.:.|.|.||......|..||   
Mouse   134 LYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVCR--- 195

  Fly   227 VYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCL 291
               |.|...::.|.........|..|:..:...||.|||:...::.|:    .|:...||::|.|
Mouse   196 ---RSFPGEDIWADVMADRVPRCPVCTGVVKPDIVFFGEQLPARFLLH----MADFALADLLLIL 253

  Fly   292 GSSLKV 297
            |:||:|
Mouse   254 GTSLEV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 58/201 (29%)
Sirt3NP_001171275.1 SIRT1 74..308 CDD:238699 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.