Sequence 1: | NP_651664.2 | Gene: | Sirt7 / 43433 | FlyBaseID: | FBgn0039631 | Length: | 771 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001171275.1 | Gene: | Sirt3 / 64384 | MGIID: | 1927665 | Length: | 334 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 LVCYTGAGISTAALIPDYRG-SQGIWTLLQKGQDIGEHDL------------------------- 164
Fly 165 ---SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNS 226
Fly 227 VYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCL 291
Fly 292 GSSLKV 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sirt7 | NP_651664.2 | SIRT7 | 124..338 | CDD:238701 | 58/201 (29%) |
Sirt3 | NP_001171275.1 | SIRT1 | 74..308 | CDD:238699 | 58/201 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0846 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |