DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and SIRT6

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_057623.2 Gene:SIRT6 / 51548 HGNCID:14934 Length:355 Species:Homo sapiens


Alignment Length:362 Identity:116/362 - (32%)
Similarity:173/362 - (47%) Gaps:66/362 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKG-QDIGEHDLSSA 167
            |.|..:|.||.:||.::.|:..:|.:||||||||:.|||:||..|:||:.::| ....:....||
Human    25 DPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESA 89

  Fly   168 NPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYWRQF 232
            .||.|||||.:|.|..||..:||||.||||:|||.||:.|:|:||||:||.|..|:...|.....
Human    90 RPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVV 154

  Fly   233 DTTEMTARYCHKTHRLC--------HRCSEPLYDTIVHFGERGNVKWPLNW---------AGATA 280
            .|..:.|     |.|||        ..|...|.|||            |:|         |.|..
Human   155 GTMGLKA-----TGRLCTVAKARGLRACRGELRDTI------------LDWEDSLPDRDLALADE 202

  Fly   281 NAQRADVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIASIKING 337
            .::.||:.:.||:||::           ||:        |:..::.:||||.|..|..|.::|:|
Human   203 ASRNADLSITLGTSLQI-----------RPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHG 256

  Fly   338 KCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTTEETQD 402
            ..|:||.:||..|.:.:|.:...:         ::...|..|.:|.....:.:|...|....:..
Human   257 YVDEVMTRLMKHLGLEIPAWDGPR---------VLERALPPLPRPPTPKLEPKEESPTRINGSIP 312

  Fly   403 STISSESCSFNYSDLPIG---KGPRIRTPIKNGRRVK 436
            :....|.|:.:....|..   :.|....|.:..:|||
Human   313 AGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 87/239 (36%)
SIRT6NP_057623.2 SIRT7 45..257 CDD:238701 87/239 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..355 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.