DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and Sirt5

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001004256.1 Gene:Sirt5 / 306840 RGDID:1303285 Length:310 Species:Rattus norvegicus


Alignment Length:270 Identity:62/270 - (22%)
Similarity:105/270 - (38%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHDLSSANPTYT------------- 172
            :.|||:|..:|||:|..:.:|.:||:.|.|...| .|.:......:.||:..             
  Rat    48 ANAKHIVIISGAGVSAESGVPTFRGTGGYWRKWQ-AQHLATPLAFAHNPSQVWEFYHYRREVMRN 111

  Fly   173 ------HMALYELHR------RRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPN 225
                  |:|:.:...      ||::  |::||.|.||.::|  ..:|.||||.::...|.:|...
  Rat   112 KEPNPGHLAIAQCEARLRDQGRRVV--VITQNIDELHRKAG--TKNLLEIHGTLFKTRCTSCGNV 172

  Fly   226 SVYWR-------------QFDTTEMTARYCHKTHRLCHRCSEP-----LYDTIVHFGERGNVKWP 272
            :..::             :.||.|...    ..|:| .||.|.     |...:|.|||..:   |
  Rat   173 AENYKSPICPALLGKGAPEPDTQESRI----PVHKL-PRCEEAGCGGLLRPHVVWFGENLD---P 229

  Fly   273 LNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAIASIKING 337
            ...........|.|:.|.:|:|..|.....:..|:   |.:...:...|::.||..........|
  Rat   230 AILKEVDRELARCDLCLVVGTSSVVYPAAMFAPQV---ASRGVPVAEFNMETTPATNRFRFHFPG 291

  Fly   338 KCDQVMAQLM 347
            .|...:.:.:
  Rat   292 PCGVTLPEAL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 59/256 (23%)
Sirt5NP_001004256.1 SIRT5_Af1_CobB 51..301 CDD:238703 61/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.