DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and Sirt4

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001100617.2 Gene:Sirt4 / 304539 RGDID:1310413 Length:319 Species:Rattus norvegicus


Alignment Length:288 Identity:77/288 - (26%)
Similarity:123/288 - (42%) Gaps:64/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 APHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQ-GIWTLLQK------------- 155
            :|.:...|:::|...||.:|.|:..|||||||.:.|||||..: |::....:             
  Rat    41 SPPLDHEKIKELQRFISLSKKLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHIDFIRSAP 105

  Fly   156 -------GQDIGEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGN 213
                   ...:|....||..|...|.||....:...||.:|:||.|.||.::|..|  |:|:||.
  Rat   106 VRQRYWARNFVGWPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQR--LTELHGC 168

  Fly   214 MYVEVCKNCRPNSV-------------YWRQ-----------FDTTEMTARY---CHKTHRLCHR 251
            |:..:|.:|...:.             .|..           |.|.|....:   |      |.|
  Rat   169 MHRVLCLSCGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQVRSFRVPC------CDR 227

  Fly   252 CSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQ-RA 315
            |..||...:|.||:..|   |..........:.||.:|.:||||:|...|.::    ..||: :.
  Rat   228 CGGPLKPDVVFFGDTVN---PDKVDFVHQRVKEADSLLVVGSSLQVYSGYRFI----LTAREKKL 285

  Fly   316 KICVVNLQWTPKDAIASIKINGKCDQVM 343
            .|.::|:..|..|.:|.:|::.:|.:::
  Rat   286 PIAILNIGPTRSDDLACLKLDSRCGELL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 71/262 (27%)
Sirt4NP_001100617.2 SIRT4 52..313 CDD:238700 75/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.