DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and Sirt6

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001026819.1 Gene:Sirt6 / 299638 RGDID:1305216 Length:330 Species:Rattus norvegicus


Alignment Length:363 Identity:112/363 - (30%)
Similarity:169/363 - (46%) Gaps:91/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQ----DIGEHDL 164
            |.|..:|.||.:||.::.|:..:|.:||||||||:.|||:||..|:||:.::|.    ||   ..
  Rat    25 DPPEELECKVWELARLMWQSSTVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDI---TF 86

  Fly   165 SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCRPNSVYW 229
            .:|.|:.|||||.:|.|...|..:||||.||||:|||.||:.|:|:||||:||.|..|:...|..
  Rat    87 ENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRD 151

  Fly   230 RQFDTTEMTARYCHKTHRLC--------HRCSEPLYDTIVHFGERGNVKWPLNWAGATAN----- 281
            ....|..:.|     |.|||        ..|...|.|||            |:|..|..:     
  Rat   152 TVVGTMGLKA-----TGRLCTVAKARGLRACRGELRDTI------------LDWEDALPDRDLTL 199

  Fly   282 ----AQRADVILCLGSSLKVLKKYTWLWQMDRPA--------RQRAKICVVNLQWTPKDAIASIK 334
                ::.||:.:.||:||::           ||:        |:..::.:||||.|..|..|.:.
  Rat   200 ADEASRTADLSVTLGTSLQI-----------RPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLC 253

  Fly   335 INGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELHTLTQPLLKNADEEEAFTTTTEE 399
            |:|..|:||.:||..|.:.:|.:...:         ::.:.|..|.:|:...|:.......:.:.
  Rat   254 IHGYVDEVMCKLMKHLGLEIPTWDGPR---------VLEKALPPLPRPVAPKAEPPVHLNGSYKP 309

  Fly   400 TQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGRRVKT 437
            ..||.:                      |.:..:||||
  Rat   310 KPDSPV----------------------PHRPPKRVKT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 85/242 (35%)
Sirt6NP_001026819.1 SIRT7 45..257 CDD:238701 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1503290at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.