DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and SIRT3

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001357239.1 Gene:SIRT3 / 23410 HGNCID:14931 Length:417 Species:Homo sapiens


Alignment Length:281 Identity:72/281 - (25%)
Similarity:110/281 - (39%) Gaps:70/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 EDAPHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRG-SQGIWTLLQKGQDIGEHDL-- 164
            :|...:|.|:.         .:.:|...||||||.:.|||:|. ..|:::.||      ::||  
Human   126 QDVAELIRARA---------CQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQ------QYDLPY 175

  Fly   165 --------------------------SSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLP 203
                                      .:..|..||..|..||.:.||..:.:||.|||...||:|
Human   176 PEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP 240

  Fly   204 RNSLSEIHGNMYVEVCKNCRPNSVYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERGN 268
            .:.|.|.||......|..|:      |.|...::.|.........|..|:..:...||.|||   
Human   241 ASKLVEAHGTFASATCTVCQ------RPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGE--- 296

  Fly   269 VKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKI---CVVNLQWTPKDAI 330
             ..|..:.....:...||::|.||:||:| :.:..|.:..|.:..|..|   .|..|.|.|:   
Human   297 -PLPQRFLLHVVDFPMADLLLILGTSLEV-EPFASLTEAVRSSVPRLLINRDLVGPLAWHPR--- 356

  Fly   331 ASIKINGKCDQVMAQLMHLLH 351
                     .:.:|||..::|
Human   357 ---------SRDVAQLGDVVH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 65/245 (27%)
SIRT3NP_001357239.1 SIRT1 138..373 CDD:238699 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.