DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and SIRT4

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001372662.1 Gene:SIRT4 / 23409 HGNCID:14932 Length:314 Species:Homo sapiens


Alignment Length:286 Identity:78/286 - (27%)
Similarity:124/286 - (43%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 APHVIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQ-GIWTL-----LQKG------- 156
            :|.:...||::|...|:.:|.|:..|||||||.:.|||||..: |::..     :|.|       
Human    36 SPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAP 100

  Fly   157 --------QDIGEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGN 213
                    ..:|....||..|...|.||....:...|:.:|:||.|.||.::|..|  |:|:||.
Human   101 IRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRR--LTELHGC 163

  Fly   214 MYVEVCKNC---RPNSVYWRQFDTTEMTARYCHKTHRL--------------------CHRCSEP 255
            |...:|.:|   .|..|...:|.....|  :..:.|.|                    |.:|...
Human   164 MDRVLCLDCGEQTPRGVLQERFQVLNPT--WSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGH 226

  Fly   256 LYDTIVHFGERGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWL---WQMDRPARQRAKI 317
            |...:|.||:..|   |..........:.||.:|.:||||:|...|.::   |:...|      |
Human   227 LKPDVVFFGDTVN---PDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLP------I 282

  Fly   318 CVVNLQWTPKDAIASIKINGKCDQVM 343
            .::|:..|..|.:|.:|:|.:|.:::
Human   283 AILNIGPTRSDDLACLKLNSRCGELL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 72/260 (28%)
SIRT4NP_001372662.1 SIRT4 47..308 CDD:238700 75/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.