DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and sir-2.3

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_510220.1 Gene:sir-2.3 / 185876 WormBaseID:WBGene00004802 Length:287 Species:Caenorhabditis elegans


Alignment Length:295 Identity:73/295 - (24%)
Similarity:122/295 - (41%) Gaps:60/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 REDAPH---VIEAKVEQLANIISQAKHLVCYTGAGISTAALIPDYRGSQ-GIWTL---------- 152
            |:..||   :.|..:::..:::.....|:..|||||||.:.|||||... |::|.          
 Worm     3 RKYVPHTTELCENSLKKFKSLVGTVDKLLIITGAGISTESGIPDYRSKDVGLYTKTALEPIYFQD 67

  Fly   153 LQKGQDIGEH----------DLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSL 207
            ..|.:...:.          ..:.|.|.:.|.||.:.......|.:::||.|||||::|  ...:
 Worm    68 FMKSKKCRQRYWSRSYLNWPRFAQALPNFNHYALSKWEAANKFHWLITQNVDGLHLKAG--SKMI 130

  Fly   208 SEIHGNMYVEVCKNCR--------------PNSVYWRQF----------DTT-EMTARYCHKTHR 247
            :|:|||.....|.:|.              .|..:..||          ||. .:.:....|...
 Worm   131 TELHGNALQVKCTSCEYIETRQTYQDRLNYANPGFKEQFVSPGQQELDADTALPLGSEQGFKIPE 195

  Fly   248 LCHRCSEPLYDTIVHFGERGNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPAR 312
             |..|...:...:..|||..|.. .:...|...|  ..:.:|.||:||:||..|    |:...|.
 Worm   196 -CLNCGGLMKTDVTLFGENLNTD-KIKVCGKKVN--ECNGVLTLGTSLEVLSGY----QIVNHAH 252

  Fly   313 QRAK-ICVVNLQWTPKDAIASIKINGKCDQVMAQL 346
            .:.| |.:||:..|..|.:|::|::.:...|:.::
 Worm   253 MQNKPIFIVNIGPTRADQMATMKLDYRISDVLKEM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 68/260 (26%)
sir-2.3NP_510220.1 SIRT4 20..284 CDD:238700 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.