DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt7 and sirt5

DIOPT Version :9

Sequence 1:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_001263631.1 Gene:sirt5 / 100170199 XenbaseID:XB-GENE-5892372 Length:309 Species:Xenopus tropicalis


Alignment Length:269 Identity:62/269 - (23%)
Similarity:103/269 - (38%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQDIGEHD-------------------LSS 166
            ::|||:...||||:|..:.:|.:||:.|.|...| .|.:...:                   :.:
 Frog    47 AKAKHIAVITGAGVSAESGVPTFRGAGGYWRKWQ-AQHLATPEAFARNPSRVWEFYHYRREVMLT 110

  Fly   167 ANPTYTHMALYELHR------RRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNC--- 222
            .||...|:|:.|...      |:|:  |::||.|.||.::| .|| |.||||:::...|.:|   
 Frog   111 KNPNPAHLAIAECETRLRKQGRKLV--VITQNIDELHRKAG-SRN-LFEIHGSLFKTRCTSCGSV 171

  Fly   223 ----------------RPNSVYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGER----- 266
                            .|...........|...| |.:     :.|:..|...:|.|||.     
 Frog   172 KENYKSPICPALAGKGAPEPDVQDAKIPVEQLPR-CDE-----NGCNGLLRPNVVWFGETLDSNL 230

  Fly   267 -GNVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAI 330
             |.|:..|         :..|:.:.:|:|..|.....:..|:   |.:...:...|::.||....
 Frog   231 LGEVEKEL---------EICDLCVVVGTSSVVYPAAMFAPQV---AARGVPVAEFNMENTPATTS 283

  Fly   331 ASIKINGKC 339
            .:....|.|
 Frog   284 FTFHFQGPC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 59/263 (22%)
sirt5NP_001263631.1 SIRT5_Af1_CobB 50..300 CDD:238703 61/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.