DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and F12

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:275 Identity:82/275 - (29%)
Similarity:115/275 - (41%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADW---FCGGVLISERFVLTAAHCLESERG--EVNVVR 127
            :|||..|.|...|::|.|          .|   ||.|.||:..:||||||||::...  |:.|| 
Mouse   355 VVGGLVALPGSHPYIAAL----------YWGNNFCAGSLIAPCWVLTAAHCLQNRPAPEELTVV- 408

  Fly   128 LGELDFDSLDEDAA-PRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEA-----VVFDLYKHPACLP 186
            ||:   |..::... .:...|..|..|.|:....:.||:.|::|.|:     .:...:..|.|||
Mouse   409 LGQ---DRHNQSCEWCQTLAVRSYRLHEGFSSITYQHDLALLRLQESKTNSCAILSPHVQPVCLP 470

  Fly   187 FQDERSSDSFI--AVGWG---------STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPR 240
            ......|::.:  ..|||         ||.|   ..||:..:.|.|..|               .
Mouse   471 SGAAPPSETVLCEVAGWGHQFEGAEEYSTFL---QEAQVPFIALDRCSN---------------S 517

  Fly   241 GFDGN----NQLCVG-SEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYT 300
            ...|:    ..||.| .|...|.|.|||||||:...........:.|:.|.|..||....||:||
Mouse   518 NVHGDAILPGMLCAGFLEGGTDACQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYT 582

  Fly   301 RVYPYLGWIARTLAT 315
            .|..||.||.:.:|:
Mouse   583 DVANYLAWIQKHIAS 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/270 (30%)
Tryp_SPc 68..309 CDD:214473 79/267 (30%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
Tryp_SPc 354..591 CDD:214473 79/267 (30%)
Tryp_SPc 355..594 CDD:238113 81/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.