DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG34409

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:296 Identity:89/296 - (30%)
Similarity:129/296 - (43%) Gaps:63/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAH 114
            |.::|||::           ||..|...:||.:.|:..|...|||..:.|.|.|||...::||||
  Fly   243 GINVESRLL-----------GGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAH 296

  Fly   115 C---LESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEA-VV 175
            |   |.|:. |::.||||..|      .|.|  :.:...|.||.|:.|::.:||.|:::... ..
  Fly   297 CVVNLVSDL-ELSHVRLGSQD------GATP--FAIEQVIVHPNYDQPKYANDIALLRINSTNGT 352

  Fly   176 FDLYKHPACLPFQ------DERSSDSFIAVGW--GST--GLALKPS---AQLLKVKLQRYGNWVC 227
            |.    |.||||.      :.......:|.||  |||  ..::.||   |.:..::|.......|
  Fly   353 FT----PICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSC 413

  Fly   228 KKLLTRQVEEF-------PRGFDGNNQLCVGSEMAQDTCNGDSGGPLL------MYHREYPCMYV 279
            ........|.|       |      |.||.......|.|.||||||.:      ::...  ..|.
  Fly   414 AIAYASLSENFQQPIVITP------NHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTS--GRYT 470

  Fly   280 VVGITSAGLS-CGSPGIPGIYTRVYPYLGWIARTLA 314
            ::||.:.|.: ||...|||:||.|..:..||.|::|
  Fly   471 IIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSIA 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 83/274 (30%)
Tryp_SPc 68..309 CDD:214473 81/271 (30%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 82/283 (29%)
Tryp_SPc 252..501 CDD:238113 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.