DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Hgfac

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006504094.1 Gene:Hgfac / 54426 MGIID:1859281 Length:658 Species:Mus musculus


Alignment Length:335 Identity:90/335 - (26%)
Similarity:131/335 - (39%) Gaps:94/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLACVFGQQPDM---------DVVGSC-SRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPL 67
            |||.|..|.|::         .|..:| .|:||..|                         ..|.
Mouse   366 SLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTF-------------------------LRPR 405

  Fly    68 IVGGHPAQPREFPHMAR--LGRRPDPSSRADWFCGGVLISERFVLTAAHCLESE--RGEVNVVRL 128
            |:||..:.|...|.:|.  :|..         ||.|.|:...:|::||||..:.  |..:.|| |
Mouse   406 IIGGSSSLPGSHPWLAAIYIGNS---------FCAGSLVHTCWVVSAAHCFANSPPRDSITVV-L 460

  Fly   129 GELDFDSLDEDAAPRDYMVAGYIAHPGYE--DPQFYHDIGLVKLTE----AVVFDLYKHPACLPF 187
            |:..|:...:  ..:.:.:..|:.:..|.  :|. .||:.|::|.:    ..|...:..|.||| 
Mouse   461 GQHFFNRTTD--VTQTFGIEKYVPYTLYSVFNPN-NHDLVLIRLKKKGERCAVRSQFVQPICLP- 521

  Fly   188 QDERSSDSF-------IAVGWG-------STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEF 238
               .:..||       || |||       ||.:: ..|..||:..:....:..|..         
Mouse   522 ---EAGSSFPTGHKCQIA-GWGHMDEMQSSTDVS-SYSNSLLEALVPLVADHKCSS--------- 572

  Fly   239 PRGFDGN---NQLCVG-SEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIY 299
            |..:..:   |.||.| .:...|.|.|||||||:........:|   ||.|.|..||....||:|
Mouse   573 PEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLY---GIISWGDGCGRLNKPGVY 634

  Fly   300 TRVYPYLGWI 309
            |||..|:.||
Mouse   635 TRVANYVDWI 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/270 (29%)
Tryp_SPc 68..309 CDD:214473 75/268 (28%)
HgfacXP_006504094.1 FN2 99..145 CDD:128373
EGF_CA 159..194 CDD:238011
FN1 197..237 CDD:238018
EGF_CA 242..275 CDD:238011
Kringle 283..364 CDD:333799
Tryp_SPc 406..646 CDD:238113 77/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.