DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:111/250 - (44%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
            |..|:||...:.|::..|..    |...:|:|||.:|...:|||||||.....|.  .:..|.  
  Fly    38 ITNGYPAYEGKVPYIVGLLF----SGNGNWWCGGSIIGNTWVLTAAHCTNGASGV--TINYGA-- 94

  Fly   133 FDSLDEDAAPRDYMVAG-YIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDS- 195
              ||........::.:| ::.|..|.....::||.|:: |..|.|....:...||..::|..|. 
  Fly    95 --SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRYQDYA 156

  Fly   196 ---FIAVGWGST--GLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMA 255
               .:|.|||.|  |..|....|.:.|::....:  |.:..:..          :|.:|:.:...
  Fly   157 GWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSD--CSRSWSLH----------DNMICINTNGG 209

  Fly   256 QDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
            :.||.|||||||:.:....     :||:||...|.| ..|.|.:::||..||.||
  Fly   210 KSTCGGDSGGPLVTHEGNR-----LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 70/249 (28%)
Tryp_SPc 68..309 CDD:214473 69/248 (28%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 69/248 (28%)
Tryp_SPc 38..262 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.