DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG9737

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:324 Identity:106/324 - (32%)
Similarity:150/324 - (46%) Gaps:67/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MDVVGSCSRYKKSVFEERIE-----FGFLLPGASIESRIIDNC-RSYTPLIVGGHPAQPREFPHM 82
            :||.   :|:|:...:.||:     .||         .:::.| :..|..|.||..|:..|||.:
  Fly   112 LDVT---ARFKRKKLKRRIQTVEPSSGF---------NLLNECGKQVTNRIYGGEIAELDEFPWL 164

  Fly    83 ARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESE----RGEVNVVRLGELDF----DSLDE- 138
            |.|....:     |:.|.|.||.:|.:||||||::.|    |..:..|||||.:.    |.::| 
  Fly   165 ALLVYNSN-----DYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEP 224

  Fly   139 ------DAAPRDYMVAGYIAHPGYEDPQF----YHDIGLVKLTEAVVFDLYKHPACLPFQDE--- 190
                  ||| .|........||.|:  :|    |:||.:::|...|.|..:..|.|||.:.|   
  Fly   225 NYLSCADAA-LDIAYEKIHVHPEYK--EFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLT 286

  Fly   191 -RSSDSFIAVGWGSTGLALK-----PSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFD---GNN 246
             .....|...|||.|.|..|     .|...||:::....|..|.|:|        .||.   |..
  Fly   287 LAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKIL--------EGFGVRLGPK 343

  Fly   247 QLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLS-CGSPGIPGIYTRVYPYLGWI 309
            |:|.|.|.|:|||.|||||||:.:.|:: ..:|..|:.|.|.: ||..|.|.:||.|..|..||
  Fly   344 QICAGGEFAKDTCAGDSGGPLMYFDRQH-SRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 96/274 (35%)
Tryp_SPc 68..309 CDD:214473 94/272 (35%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 94/273 (34%)
Tryp_SPc 150..409 CDD:238113 96/274 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.