DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:73/259 - (28%)
Similarity:115/259 - (44%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TPL------IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV 123
            ||:      |..|:||...:.|::..|..    |...:|:|||.:|...:|||||||.....|. 
  Fly    27 TPIKDIQGRITNGYPAYEGKVPYIVGLLF----SGNGNWWCGGSIIGNTWVLTAAHCTNGASGV- 86

  Fly   124 NVVRLGELDFDSLDEDAAPRDYMVAG-YIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPF 187
             .:..|.    |:........::.:| .|.|..|.....::||.|:: |..|.|....:...||.
  Fly    87 -TINYGA----SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVDFWSLVNKVELPS 145

  Fly   188 QDERSSDS----FIAVGWGST--GLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNN 246
            .::|..|.    .:|.|||.|  |..|....|.:.|::....:  |.:..:..          :|
  Fly   146 YNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSD--CSRTWSLH----------DN 198

  Fly   247 QLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
            .:|:.::..:.||.|||||||:.:....     :||:||.|.:.| ..|.|.:::||..||.||
  Fly   199 MICINTDGGKSTCGGDSGGPLVTHDGNR-----LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 71/250 (28%)
Tryp_SPc 68..309 CDD:214473 69/248 (28%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.