DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG11841

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:319 Identity:162/319 - (50%)
Similarity:206/319 - (64%) Gaps:11/319 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWRLFSQLIVSL--ACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRS 63
            |:...|...|:.||  :.|.||.||.....:|:::|:.|||||:...|....|.|....:|:|..
  Fly     3 MQSLELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHG 67

  Fly    64 YTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRL 128
            ..||||.|.||:|:|||..||||.| ..::...|||||.|||.|.|||||||..||.||||||||
  Fly    68 SRPLIVDGTPAEPKEFPFAARLGHR-KTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131

  Fly   129 GELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSS 193
            |||:||:..:||.|.|:.|....||||:|:||.|:|||:|:|...|.|:.|||||||||.|....
  Fly   132 GELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQH 196

  Fly   194 DSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQV---EEFPRGFDGNNQLCVGSEMA 255
            :||||:|||....|.|.|.:||||:||.|     |......|   :|.|.|::..:|||:||...
  Fly   197 ESFIAIGWGQKKFAQKESKKLLKVQLQGY-----KDRCVSSVDANDELPNGYEPKSQLCIGSRDN 256

  Fly   256 QDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIARTLA 314
            :||||||||||:|.||::..|||.|:||||||::|.:|.||..||||:.:|.||...||
  Fly   257 KDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGELA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 136/246 (55%)
Tryp_SPc 68..309 CDD:214473 134/243 (55%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 135/244 (55%)
Tryp_SPc 72..310 CDD:214473 134/243 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468440
Domainoid 1 1.000 204 1.000 Domainoid score I6255
eggNOG 1 0.900 - - E33208_3BPQ8
Homologene 1 1.000 - - H116049
Inparanoid 1 1.050 214 1.000 Inparanoid score I6028
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25874
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 1 1.000 - - otm49624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1211.910

Return to query results.
Submit another query.