DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG4815

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:100/238 - (42%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CGGVLISERFVLTAAHCLES-ERGEVNVVRLGELDF----DSLDEDAAPRDYMVAGYIAHPGYED 158
            |...|::.|.:||||||.|: .|.:.:|:.....:|    ::.:::...|..:      ||.|..
  Fly    61 CSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQI------HPKYAK 119

  Fly   159 PQFYHD--------------IGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTG---- 205
            .:|..|              ||..:|..:|:     ||          .|..||.|||..|    
  Fly   120 MKFIADVAVAKTKYPLRSKYIGYAQLCRSVL-----HP----------RDKLIAAGWGFEGGVWD 169

  Fly   206 LALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMY 270
            .:.|.:.:.:||.:....:  |:|.|.|::..        |.:|.|:...:..|.||||||||:.
  Fly   170 ESRKKTFRSMKVGIVSKRD--CEKQLDRKMPP--------NIICAGAYNNKTLCFGDSGGPLLLG 224

  Fly   271 HREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIARTL 313
            .:       |.||.:....||:...|.:|..|..|..:|.||:
  Fly   225 RQ-------VCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 61/235 (26%)
Tryp_SPc 68..309 CDD:214473 60/232 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 61/235 (26%)
Trypsin 49..256 CDD:278516 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.