DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and SPE

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:307 Identity:98/307 - (31%)
Similarity:143/307 - (46%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLI 104
            :.::.|.:|||..:...:      :...|.||......|||.|..|..:...|....:.|||.|:
  Fly   113 DALQQGDVLPGNDVCGFL------FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALL 171

  Fly   105 SERFVLTAAHCLES----ERGEV-NVVRLGELDFDSLDED----------AAPR--DYMVAGYIA 152
            :.|:||||.|||.|    :.|.| :.|||||.| ...|.|          .||:  |..|...|.
  Fly   172 NSRYVLTAGHCLASRELDKSGAVLHSVRLGEWD-TRTDPDCTTQMNGQRICAPKHIDIEVEKGII 235

  Fly   153 H----PGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFI-----AVGWGSTGLAL 208
            |    |...|.:  :||.||:|...|.:..|..|.||| .|....::|:     ..|||.|. .:
  Fly   236 HEMYAPNSVDQR--NDIALVRLKRIVSYTDYVRPICLP-TDGLVQNNFVDYGMDVAGWGLTE-NM 296

  Fly   209 KPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHRE 273
            :|||..||:.:..:....|::    :...|....| ::|:|.|.::..|||.|||||||::    
  Fly   297 QPSAIKLKITVNVWNLTSCQE----KYSSFKVKLD-DSQMCAGGQLGVDTCGGDSGGPLMV---- 352

  Fly   274 YPC------MYVVVGITSAGLS-CGSPGIPGIYTRVYPYLGWIARTL 313
             |.      ::.:.|:||.|.. ||..|.||:|||...::.||.:.|
  Fly   353 -PISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 93/276 (34%)
Tryp_SPc 68..309 CDD:214473 91/273 (33%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 93/276 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.