DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG31199

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:251 Identity:63/251 - (25%)
Similarity:87/251 - (34%) Gaps:86/251 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AQPREFPHMARL--GRRPDPSSRADWFCGGVLISERFVLTAAHCLESERG--EVNVVRLGELDFD 134
            |.|.|...:||:  |:..:...| |..|.|||:|:|.||..|||.....|  |...|.||     
  Fly    45 AIPTEHQWVARIVYGKGFEGKIR-DNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLG----- 103

  Fly   135 SLDEDAAPRDYMVA---GYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF 196
             :...:||....|.   ||...|..|          :||.|..:     ||.    .|.|:..:.
  Fly   104 -VHNKSAPVGVRVCETDGYCVRPSQE----------IKLAEIAI-----HPD----YDSRTLKNS 148

  Fly   197 IAVGWGSTGLALKPSAQLLKVKLQRYGNW--VC---KKLLT-------------RQVEEF----- 238
            :||      |.|:..|::       |.|.  :|   ..||.             |..|:|     
  Fly   149 LAV------LTLQRDAKI-------YPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKTW 200

  Fly   239 ----PRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYV---VVGITSAG 287
                .|||      |........|    |...:..||::....|:   :||:...|
  Fly   201 VNTLSRGF------CQSKVKTLVT----SSNTVCGYHKQPVAYYLGAPLVGLQKKG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 63/251 (25%)
Tryp_SPc 68..309 CDD:214473 63/251 (25%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.