DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG31219

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:336 Identity:97/336 - (28%)
Similarity:137/336 - (40%) Gaps:70/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWRLFSQLIVSLAC--VFGQQPDMDVVG-SCSRYKKSVFEERIEFGFLLPGASIESRIIDNCR 62
            |..|.||.|.|   .|  ...:.|..::.| |.|.|:                            
  Fly    55 MDAWLLFGQRI---CCPPPGNRLPSTEICGQSLSTYR---------------------------- 88

  Fly    63 SYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNV-- 125
                 :|||..|:|..:|.||.|......:.....||.|.||:.|:|||:|||:.....::::  
  Fly    89 -----MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKS 148

  Fly   126 VRLGELDF--------DSLDED---AAPR-DYMVAGYIAH---PGYEDPQFYHDIGLVKLTEAVV 175
            |||||.|.        |..|:|   |.|. :..:...|.|   ....:....:||.|::|...|.
  Fly   149 VRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVR 213

  Fly   176 FDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPR 240
            :.....|.|:|.....:.......|||.|.     ..|..:|.:.   .::.::.:......||.
  Fly   214 YRTGIMPICIPKHGFFAKSKLEIAGWGKTN-----EGQFSQVLMH---GFIRERSIAVCALRFPY 270

  Fly   241 GFDGNN--QLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAG-LSCGSPGIPGIYTRV 302
             .|.|.  |:|.|.....|||.|||||| ||...:...:| :.|||:.| .:||..||||||||.
  Fly   271 -LDLNQSLQICAGGYDGVDTCQGDSGGP-LMVTMDNSSVY-LAGITTYGSKNCGQIGIPGIYTRT 332

  Fly   303 YPYLGWIARTL 313
            ..:|.||...|
  Fly   333 SAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 84/263 (32%)
Tryp_SPc 68..309 CDD:214473 82/260 (32%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 82/294 (28%)
Tryp_SPc 90..342 CDD:238113 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.