DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG5246

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:328 Identity:80/328 - (24%)
Similarity:132/328 - (40%) Gaps:78/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWRLFSQLIVSLACVFGQQPDMDVVGSCSRYKKSV-FEERIEFGFLLPGASIESRIIDNCRSY 64
            ||...|.|.|:              ::..||  .||| ...|.:....|.....|:|:|....|.
  Fly     1 MKCLVLISVLV--------------ILSQCS--AKSVKIHRRHQLNHHLGHVKPETRVIGGVDSP 49

  Fly    65 TPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLG 129
            |..       .|.:...|...|         :..|||.:|:.:::||||||:|.....:.:| .|
  Fly    50 TGF-------APYQVSIMNTFG---------EHVCGGSIIAPQWILTAAHCMEWPIQYLKIV-TG 97

  Fly   130 ELDFDSLDEDAAP-RDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDE--R 191
            .:|:      ..| .:|:|.|...|..::.|.:::||.|:...:.:|:|....|..|..:..  :
  Fly    98 TVDY------TRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPK 156

  Fly   192 SSDSFIAVGWGSTGLALKPSAQLLKVKLQ-----------RYGNWVCKKLLTRQVEEFPRGFDGN 245
            ..|.....|||||....:.|.||.|:.|.           |..||:                 ..
  Fly   157 VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWL-----------------SE 204

  Fly   246 NQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIA 310
            ..:|..::..:.:|:|||||||:..::      .:||:.:.|.:| :.|.|.::..|..|..||.
  Fly   205 GHVCTFTQEGEGSCHGDSGGPLVDANQ------TLVGVVNWGEAC-AIGYPDVFGSVAYYHDWIE 262

  Fly   311 RTL 313
            :.:
  Fly   263 QMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 63/257 (25%)
Tryp_SPc 68..309 CDD:214473 61/254 (24%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/266 (24%)
Tryp_SPc 42..263 CDD:238113 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.