DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG17475

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:307 Identity:82/307 - (26%)
Similarity:127/307 - (41%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIVSLACVFGQQPDMDVVGSCSRYK-------KSVFEERIEFGFLLPGASIESRIIDNCRSYTPL 67
            |::.|||            :|  ||       ..:.|:::|:.....|.:.::|:|:        
  Fly    10 LVILLAC------------TC--YKPISAVRLAQLSEDQLEWISKAEGVNFQNRVIN-------- 52

  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
               |...|..|..:...|     ........|||.:|.||.|||||||:.........|..|.::
  Fly    53 ---GEDVQLGEAKYQISL-----QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVE 109

  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFI 197
            ::.  .||.   |.|..:..|..|..|.:::||.|::|.:.:.|:.|..||.||.....:....:
  Fly   110 YEK--PDAV---YFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLL 169

  Fly   198 AVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGD 262
            ..|||||.|.......|.|..|.......|::::.....      :|...:|..:...|..|:||
  Fly   170 LTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPS------NGPCHICTLTTGGQGACHGD 228

  Fly   263 SGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            |||||.  |..     |:.|:.:.|..| :.|:|..:..||.||.||
  Fly   229 SGGPLT--HNG-----VLYGLVNWGYPC-ALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 70/242 (29%)
Tryp_SPc 68..309 CDD:214473 68/240 (28%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/252 (28%)
Tryp_SPc 50..269 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.