DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG17477

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:118/252 - (46%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
            ||||..|...:.|:...|     .:......|||.:||:|:::||.||::........|..|.:.
  Fly    27 IVGGQNAAEGDAPYQVSL-----QTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIR 86

  Fly   133 FDSLDEDAAPRD--YMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQD-ERSSD 194
            :      |.|..  |..|.|: |..|:.|::.:||||:.|.|::.|:.......||... .|.:.
  Fly    87 Y------AEPGAVYYPDAIYL-HCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGAS 144

  Fly   195 SFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLT--RQVEEFPRGFDGNNQLCVGSEMAQD 257
            ..:..||||...|....:||.:|:.|...:..|:.:::  ..:|..|.......|..:|:     
  Fly   145 ELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGA----- 204

  Fly   258 TCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIARTLA 314
             |:|||||||:  |:.     .:|||.:..:.| :.|:|.|:..:..|..|:.:|::
  Fly   205 -CHGDSGGPLV--HQG-----TLVGILNFFVPC-AQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 69/248 (28%)
Tryp_SPc 68..309 CDD:214473 68/245 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/248 (28%)
Tryp_SPc 27..246 CDD:214473 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.