DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and modSP

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:205 Identity:41/205 - (20%)
Similarity:68/205 - (33%) Gaps:76/205 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CGGVLISERFVLTAAHCL------------------------------ESERGEVNVVRLGELDF 133
            |||.|::...|:|||||:                              |.:|.:|.::.:.    
  Fly   399 CGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIA---- 459

  Fly   134 DSLDEDAAPRDYMVAGYIAHPGYE--DPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF 196
                                |||:  ...:|.|:.|:.|.|.........|.|:.|......:|.
  Fly   460 --------------------PGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESV 504

  Fly   197 I------AVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMA 255
            .      ..||.     ::...:|..|......|.||::.| |.::.        ::.|:.::..
  Fly   505 TDDVQGKFAGWN-----IENKHELQFVPAVSKSNSVCRRNL-RDIQA--------DKFCIFTQGK 555

  Fly   256 QDTCNGDSGG 265
            ...|.|||||
  Fly   556 SLACQGDSGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 41/205 (20%)
Tryp_SPc 68..309 CDD:214473 41/205 (20%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 41/205 (20%)
Tryp_SPc 371..591 CDD:304450 41/205 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.