DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG8870

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:111/264 - (42%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EFPHMARL--GRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGE----VNVVRLGELDFDSL 136
            |||.||.|  |.:.:.|.:....|||.||:..:|||||||:|....:    :..|||||.:..:.
  Fly    94 EFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTN 158

  Fly   137 DEDA--------APRDYM---VAGYIAHPGY-EDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQD 189
            .:.|        ||. ||   |...|.|..: ...:..:||.||:|...|.:.....|.|||...
  Fly   159 PDRAIVNGRRQYAPL-YMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQ 222

  Fly   190 ERSSD--SFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGN--NQLCV 250
            :.::.  .|.|.||...|..:.....|.....:|:.: |||.           .:|.|  :|:|.
  Fly   223 KLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPD-VCKS-----------NYDFNLGSQICA 275

  Fly   251 GSEMAQDTCNGDSGGPLL-MYHREYPCMYVVVGITSAGLSCGSPGI-----PGIYTRVYPYLGWI 309
            |.....||..|||||||: ...|....:....||.|.|   ..|.:     |..||:...:..||
  Fly   276 GGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYG---QKPCVLKTCKPAFYTKTSYFFEWI 337

  Fly   310 ARTL 313
            ...|
  Fly   338 KSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/261 (30%)
Tryp_SPc 68..309 CDD:214473 77/258 (30%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 79/261 (30%)
Tryp_SPc 93..337 CDD:214473 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.