DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and MP1

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:288 Identity:95/288 - (32%)
Similarity:129/288 - (44%) Gaps:41/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLPGASIESRIIDNC-RSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVL 110
            |||.|       .|| .::...:|||:....||||.|| |.....|.:.....|||.||:.|:||
  Fly   123 LLPMA-------PNCGENFGDRVVGGNETTKREFPWMA-LIEYTKPGNVKGHHCGGSLINHRYVL 179

  Fly   111 TAAHCLES--ERGEVNVVRLGELDFDSLDEDAAPR-----------DYMVAGYIAHPGY--EDPQ 160
            |||||:.:  ...|:..|||||.|..:..:....:           ||.|...|.||.|  ....
  Fly   180 TAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRD 244

  Fly   161 FYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF-----IAVGWGSTGLALKPSAQLLKVKLQ 220
            ..:||.|::|.:.|.:..:..|.|||....:.::.|     :..|||.|......:.: ||.:|.
  Fly   245 QLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIK-LKAELD 308

  Fly   221 RYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYP---CMYVVVG 282
            ......|.:....|     |......|:|.|.....|:|.||||||||:  .:|.   ..|.:.|
  Fly   309 TVPTSECNQRYATQ-----RRTVTTKQMCAGGVEGVDSCRGDSGGPLLL--EDYSNGNSNYYIAG 366

  Fly   283 ITSAG-LSCGSPGIPGIYTRVYPYLGWI 309
            :.|.| ..||..|.||:||||..||.||
  Fly   367 VVSYGPTPCGLKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 89/266 (33%)
Tryp_SPc 68..309 CDD:214473 87/264 (33%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 87/265 (33%)
Tryp_SPc 138..397 CDD:238113 89/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.