DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG18223

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:247 Identity:63/247 - (25%)
Similarity:101/247 - (40%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RRPDPSSRADWFCGGVLISERFVLTAAHCLESER-------------GEVNVVRLGELDFDSLDE 138
            |||......:.|||||:||..::||:|||...:|             |..|  ||......||:.
  Fly    67 RRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTN--RLKSRKGLSLNM 129

  Fly   139 DA----APRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPAC----LPFQDERSSDS 195
            :.    .|..:.|..            .::|.|:.|.:.:..|   :|..    ||..|.....:
  Fly   130 EVKKIFVPDKFTVFN------------TNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLN 179

  Fly   196 FIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVG---SEMAQD 257
            :..:|||........::.:|.:.::.....:|:|.:....||         .:|.|   :.|.::
  Fly   180 YTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEE---------MMCAGNLNNTMDEN 235

  Fly   258 TCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            .|.||:|.||:...       .|.|:.|..:.|||..:|.|||.||.::.||
  Fly   236 PCAGDTGSPLIFNE-------TVFGVVSYRVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 63/247 (26%)
Tryp_SPc 68..309 CDD:214473 61/245 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 63/247 (26%)
Tryp_SPc 60..280 CDD:214473 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.