DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG7542

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:308 Identity:88/308 - (28%)
Similarity:132/308 - (42%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPRE 78
            |.||.       :||||:                         .:.......|.|..|.||:..:
  Fly     5 LVCVL-------LVGSCT-------------------------AVPLLTDVEPYITNGEPAEVGQ 37

  Fly    79 FPHMARLGRRPDPSSRADW--FCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAA 141
            ||:.|.|.     .|..:|  :|||.|||..:::|||||::.  .|...|.||.::.....|:..
  Fly    38 FPYQAGLN-----VSFGNWSTWCGGTLISHYWIITAAHCMDG--AESVTVYLGAINIGDESEEGQ 95

  Fly   142 PRDYMV--AGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLP------FQDERSSDSFIA 198
            .| .||  :|.|.|..|......:||.|::|...|.|......|.||      |....|..:| |
  Fly    96 ER-IMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAF-A 158

  Fly   199 VGWGSTGLALKPSAQLLK-VKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGD 262
            .|||....|....:.:|: |::....:.:|:...:..|.|        ..:|:.:...:.||:||
  Fly   159 SGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSE--------KMICMSTTSGKSTCHGD 215

  Fly   263 SGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
            |||||:  :::....| ::|.||.|.|.| ..|.|.::||:..||.||
  Fly   216 SGGPLV--YKQGNSSY-LIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 80/254 (31%)
Tryp_SPc 68..309 CDD:214473 78/252 (31%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 80/254 (31%)
Tryp_SPc 27..260 CDD:214473 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.